제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD16 mAb (A24937)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 Neuro-2a cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with ABflo® 594 Rabbit anti-Mouse CD16 mAb (A24937, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD16 mAb (A24937, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD16 mAb
Catalog No.	A24937
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64354-ABflo594

Background

Enables IgG binding activity and IgG receptor activity. Acts upstream of or within several processes, including antibody-dependent cellular cytotoxicity; phagocytosis; and positive regulation of hypersensitivity. Located in external side of plasma membrane. Is expressed in liver and spleen. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); dengue disease (multiple); hematologic cancer (multiple); leukopenia (multiple); and malaria (multiple). Orthologous to human FCGR2A (Fc fragment of IgG receptor IIa).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 38-207 of mouse CD16(NP_034318.2).
Sequence	LPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNWSSIRSQVQSSYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQD
Gene ID
Swiss Prot
Synonyms	CD16
Calculated MW	30kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Membrane, Secreted