Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:SARS-CoV-2
Product name | SARS-CoV-2 Spike RBD (N501Y) Rabbit mAb |
---|---|
Catalog No. | A21254 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC52673 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-550 of coronavirus SARS-CoV-2 Spike RBD (N501Y) (YP_009724390.1). |
---|---|
Sequence | NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG |
Gene ID | |
Swiss Prot | |
Synonyms | spike glycoprotein; SARS-CoV-2 Spike RBD (N501Y) |
Calculated MW | 141KD |
Observed MW | 36kDa |
Reactivity | SARS-CoV-2 |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Recombinant SARS-CoV-2 Spike RBD (N501Y) Protein(RP01258) |
Cellular location | nuclear capsid. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21254? Please let us know so that we can cite the reference in this datasheet.