제품 > 항체 > 단일클론항체(mAb)

SARS-CoV-2 Spike S1 Rabbit mAb (A20834)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:SARS-CoV-2

Western blot analysis of lysates from 293T cells and 293T cells transfected with SARS-CoV-2 Spike S1, using SARS-CoV-2 Spike S1 Rabbit mAb (A20834) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - SARS-CoV-2 Spike S1 Rabbit mAb (A20834)

Immunofluorescence analysis of 293T cells transfected with S1 and 293T cells using SARS-CoV-2 Spike S1 Rabbit mAb (A20834) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	SARS-CoV-2 Spike S1 Rabbit mAb
Catalog No.	A20834
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51489

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1).
Sequence	YFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
Gene ID
Swiss Prot
Synonyms	spike glycoprotein; SARS-CoV-2 Spike S1
Calculated MW	141kDa
Observed MW	110kDa

Applications

Reactivity	SARS-CoV-2
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T cells transfected with SARS-CoV-2 Spike S1 Protein
Cellular location
Customer validation	IF(Homo sapiens) WB(Homo sapiens) ELISA(Mus musculus) WB(Mus musculus) Other(Mus musculus)