제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD79b mAb (A25449)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C2C12 cells (negative control, left) and A20 cells (right) were surface-stained with ABflo® 594 Rabbit anti-Mouse CD79b mAb (A25449, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 A20 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD79b mAb (A25449, 5 μl/Test, right).

Flow cytometry: 1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 594 Rabbit anti-Mouse CD79b mAb (A25449, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained C57BL/6 mouse Splenocytes were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD79b mAb (A25449, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD79b mAb
Catalog No.	A25449
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66113-ABflo594

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-158 of mouse CD79b (NP_032365.1).
Sequence	VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD
Gene ID
Swiss Prot
Synonyms	B29; Igb; Igbeta; Ig-beta
Calculated MW	25kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 594 Rabbit anti-Mouse CD79b mAb images

Flow CytoMetry - ABflo® 594 Rabbit anti-Mouse CD79b mAb (A25449)

Flow cytometry: 1X10^6 A20 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD79b mAb (A25449, 5 μl/Test, right).

Flow CytoMetry - ABflo® 594 Rabbit anti-Mouse CD79b mAb (A25449)

* For research use only. Not for therapeutic or diagnostic purposes.