Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Western blot analysis of lysates from Mouse spleen using CD79b Rabbit mAb (A25358) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Confocal imaging of A20 cells using CD79b Rabbit mAb (A25358, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of paraffin-embedded Mouse spleen using CD79b Rabbit mAb (A25358, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Mouse thymus using CD79b Rabbit mAb (A25358, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Flow cytometry: 1X10^6 C2C12 cells (negative control, left) and A20 (right) cells were surface-stained with Mouse CD79b mAb (A25358, 2 μg/mL, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line), followed by PE conjugated Donkey anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 A20 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or Mouse CD79b mAb (A25358, 2 μg/mL, right).
Flow cytometry: 1X10^6 C57BL/6 mouse Splenocytes were surface-stained with Mouse CD79b mAb (A25358, 2 μg/mL, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line), followed by PE Donkey anti-rabbit Antibody staining. Non-fluorescently stained cells were used as blank control (red line).
| Product name | CD79b Rabbit mAb |
|---|---|
| Catalog No. | A25358 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC66113 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-158 of mouse CD79b (NP_032365.1). |
|---|---|
| Sequence | VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | B29; Igb; Igbeta; Ig-beta |
| Calculated MW | 25kDa |
| Observed MW | 30-50kDa |
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Flow Cytometry |
| Positive samples | Mouse spleen |
| Cellular location | Cell membrane, Single-pass type I membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
i_FC_01.jpg?t=1711071483)
i_FC_01.jpg?t=1712798435)
Y_FC_01.jpg?t=1711071481)
U1_FC_01.jpg?t=1717139042)
