제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD336/NK-p44 mAb (A27277)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human CD336/NK-p44 mAb (A27277, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD336/NK-p44 mAb (A27277, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC (treated with rhIL-2) were surface-stained with PE Mouse anti-Human CD56 mAb (A26868, 5 μl/Test) and ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD336/NK-p44 mAb (A27277, 5 μl/Test, right). Cells in the lymphocyte gate were used for analysis.

Overview

Product name	ABflo® 647 Rabbit anti-Human CD336/NK-p44 mAb
Catalog No.	A27277
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69299-ABflo647

Background

Predicted to enable signaling receptor activity. Predicted to be involved in cellular defense response and signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane. Predicted to be active in cell surface.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-190 of human CD336/NK-p44 (NP_004819.2).
Sequence	QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP
Gene ID
Swiss Prot
Synonyms	LY95; CD336; NKP44; NK-p44; dJ149M18.1
Calculated MW	31kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein.