Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ABflo® 647 Rabbit anti-Human CD51 mAb |
---|---|
Catalog No. | A22299 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50621-ABflo647 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human CD51 (NP_002201.2). |
---|---|
Sequence | SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
Gene ID | |
Swiss Prot | |
Synonyms | CD51; MSK8; VNRA; VTNR |
Calculated MW | 116kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | |
Positive samples | |
Cellular location | Cell surface, Cytosol, External side of plasma membrane, Extracellular exosome, Filopodium membrane, Focal adhesion, Lamellipodium membrane, Mmicrovillus membrane, Phagocytic vesicle, Plasma membrane, Ruffle membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.