제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD51 mAb (A22299)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 MOLT-4 cells (Low Expression, left) and BeWo cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human CD51 mAb(A22299, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 BeWo cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD51 mAb(A22299, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD51 mAb
Catalog No.	A22299
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC50621-ABf647

Background

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human CD51 (NP_002201.2).
Sequence	SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Gene ID
Swiss Prot
Synonyms	CD51; MSK8; VNRA; VTNR
Calculated MW	116kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cell surface, Cytosol, External side of plasma membrane, Extracellular exosome, Filopodium membrane, Focal adhesion, Lamellipodium membrane, Mmicrovillus membrane, Phagocytic vesicle, Plasma membrane, Ruffle membrane