제품 > 항체 > 다중클론항체(pAb)

Integrin alpha V (ITGAV/CD51) Rabbit pAb (A2091)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Integrin alpha V (ITGAV/CD51) Rabbit pAb (A2091) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of lysates from MCF7 cells, using Integrin alpha V (ITGAV/CD51) Rabbit pAb (A2091) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Integrin alpha V (ITGAV/CD51) Rabbit pAb (A2091)

Immunohistochemistry analysis of paraffin-embedded Rat testis using Integrin alpha V (ITGAV/CD51) Rabbit pAb (A2091) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - Integrin alpha V (ITGAV/CD51) Rabbit pAb (A2091)

Immunoprecipitation analysis of 200 μg extracts of C6 cells using 3 μg Integrin alpha V (ITGAV/CD51) antibody (A2091). Western blot was performed from the immunoprecipitate using Integrin alpha V (ITGAV/CD51) antibody (A2091) at a dilution of 1:2000.

Overview

Product name	Integrin alpha V (ITGAV/CD51) Rabbit pAb
Catalog No.	A2091
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 950-1048 of human Integrin alpha V (ITGAV/CD51) (NP_002201.1).
Sequence	LKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Gene ID
Swiss Prot
Synonyms	CD51; MSK8; VNRA; VTNR; Integrin alpha V (ITGAV/CD51)
Calculated MW	116kDa
Observed MW	130kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	MCF7, NIH/3T3, C6
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	WB(Homo sapiens, Mus musculus, Escherichia coli) IHC(Escherichia coli)