제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD90/Thy1 mAb (A22511)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 K-562 cells (negative control, left) and U-251MG cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD90/Thy1 mAb(A22511, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 U-251MG cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD90 mAb(A22511, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD90/Thy1 mAb
Catalog No.	A22511
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55641-ABf647

Background

This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CD90/Thy1 (NP_006279.2).
Sequence	QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Gene ID
Swiss Prot
Synonyms	CD90; CDw90
Calculated MW	18kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Apical plasma membrane, Cell surface, Cytosol, Endoplasmic reticulum, External side of plasma membrane, Extracellular exosome, Extracellular region, focal adhesion, Plasma membrane
Customer validation	FC(Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Rabbit anti-Human CD90/Thy1 mAb images

Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD90/Thy1 mAb (A22511)

Flow cytometry:1X10^6 U-251MG cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD90 mAb(A22511, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.