제품 > 항체 > 단일클론항체(mAb)

[KD Validated] CD90/Thy1 Rabbit mAb (A23224)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from U-251 MG cells using [KD Validated] CD90/Thy1 Rabbit mAb (A23224) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of lysates from wild type(WT) and CD90/Thy1 knockdown (KD) U-2 OS cells using [KD Validated] CD90/Thy1 Rabbit mAb (A23224) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Flow CytoMetry - [KD Validated] CD90/Thy1 Rabbit mAb (A23224)

Flow cytometry: 1X10^6 K-562 cells (negative control, left) and U-251 MG cells (right) were surface-stained with [KD Validated] CD90/Thy1 Rabbit mAb (A23224, 2 μg/mL, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line), followed by PE Donkey anti-rabbit Antibody staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 U-251 MG cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or [KD Validated] CD90/Thy1 Rabbit mAb (A23224, 2 μg/mL, right).

Overview

Product name	[KD Validated] CD90/Thy1 Rabbit mAb
Catalog No.	A23224
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55647

Background

This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CD90/Thy1 (NP_006279.2).
Sequence	QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Gene ID
Swiss Prot
Synonyms	CD90; CDw90; [KO/KD Validated] CD90/Thy1
Calculated MW	18kDa
Observed MW	22-30kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000 FC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	U-251 MG, U-2 OS
Cellular location	Cell membrane, GPI-anchor, Lipid-anchor

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] CD90/Thy1 Rabbit mAb images

Western blot - [KD Validated] CD90/Thy1 Rabbit mAb (A23224)

Flow CytoMetry - [KD Validated] CD90/Thy1 Rabbit mAb (A23224)

Flow cytometry: 1X10^6 U-251 MG cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or [KD Validated] CD90/Thy1 Rabbit mAb (A23224, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.