Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ABflo® 647 Rabbit anti-Human KIR2DL2/KIR2DL3 mAb |
---|---|
Catalog No. | A24575 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC62218-ABflo647 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3(NP_056952.2). |
---|---|
Sequence | HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH |
Gene ID | |
Swiss Prot | |
Synonyms | KIR2DL3; CD158B2; CD158b; GL183; KIR-023GB; KIR-K7b; KIR-K7c; KIR2DS5; KIRCL23; NKAT; NKAT2; NKAT2A; NKAT2B; p58; killer cell immunoglobulin-like receptor 2DL3 |
Calculated MW | 27kDa/37kDa/38kDa |
Observed MW | Refer to figures |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Immunofluorescence Flow Cytometry |
Positive samples | |
Cellular location | Cell membrane, Single-pass type I membrane protein |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.