제품 > 항체 > 단일클론항체(mAb)

KIR2DL2/KIR2DL3 Rabbit mAb (A24577)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with KIR2DL2, using KIR2DL2/KIR2DL3 Rabbit mAb (A24577) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - KIR2DL2/KIR2DL3 Rabbit mAb (A24577)

Confocal imaging of 293F-KIR2DL3 and 293F cells using KIR2DL2/KIR2DL3 Rabbit mAb (A24577, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Confocal imaging of CHO-KIR2DL2 and CHO cells using KIR2DL2/KIR2DL3 Rabbit mAb (A24577, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Flow CytoMetry - KIR2DL2/KIR2DL3 Rabbit mAb (A24577)

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with KIR2DL2/KIR2DL3 Rabbit mAb(A24577, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or KIR2DL2/KIR2DL3 Rabbit mAb(A24577, 2 μg/mL, right).

Flow cytometry: 1X10^6 CHO cells (negative control, left) and CHO(Transfection, right) cells were surface-stained with KIR2DL2/KIR2DL3 Rabbit mAb(A24577, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 CHO(Transfection) cells cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or KIR2DL2/KIR2DL3 Rabbit mAb(A24577, 2 μg/mL, right).

Overview

Product name	KIR2DL2/KIR2DL3 Rabbit mAb
Catalog No.	A24577
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62218

Background

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several 'framework' genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3(NP_056952.2).
Sequence	HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Gene ID
Swiss Prot
Synonyms	KIR2DL3; CD158B2; CD158b; GL183; KIR-023GB; KIR-K7b; KIR-K7c; KIR2DS5; KIRCL23; NKAT; NKAT2; NKAT2A; NKAT2B; p58; killer cell immunoglobulin-like receptor 2DL3; KIR2DL2/KIR2DL3
Calculated MW	27kDa/37kDa/38kDa
Observed MW	40-55kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:12000 IF/ICC 1:200-1:800 FC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Flow Cytometry
Positive samples	293T transfected with KIR2DL2
Cellular location	Cell membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KIR2DL2/KIR2DL3 Rabbit mAb images

Western blot - KIR2DL2/KIR2DL3 Rabbit mAb (A24577)

Immunofluorescence - KIR2DL2/KIR2DL3 Rabbit mAb (A24577)