제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human Syndecan 4 mAb (A26066)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 MOLT-4 cells (negative control, left) and RT4 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human Syndecan 4 mAb (A26066, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 RT4 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Syndecan 4 mAb (A26066, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human Syndecan 4 mAb
Catalog No.	A26066
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66675-ABflo647

Background

The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-145 of human Syndecan 4 (NP_002990.2).
Sequence	ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
Gene ID
Swiss Prot
Synonyms	SYND4
Calculated MW	22kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Secreted, Secreted, Single-pass type I membrane protein.