제품 > 항체 > 단일클론항체(mAb)

Syndecan 4 Rabbit mAb (A26116)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from MCF7 cells using Syndecan 4 Rabbit mAb (A26116) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - Syndecan 4 Rabbit mAb (A26116)

Confocal imaging of paraffin-embedded Human liver tissue using Syndecan 4 Rabbit mAb (A26116, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

ABclonal:Flow CytoMetry - Syndecan 4 Rabbit mAb (A26116)

Flow cytometry: 1X10^6 MOLT-4 cells (negative control, left) and RT4 cells (right) were surface-stained with Syndecan 4 Rabbit mAb (A26116, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 RT4 cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or Syndecan 4 Rabbit mAb (A26116, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	Syndecan 4 Rabbit mAb
Catalog No.	A26116
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66675

Background

The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-145 of human Syndecan 4 (NP_002990.2).
Sequence	ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
Gene ID
Swiss Prot
Synonyms	SYND4
Calculated MW	22kDa
Observed MW	29kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3
Key application	Western blotting Immunofluorescence Flow Cytometry
Positive samples	MCF7
Cellular location	Membrane, Secreted, Secreted, Single-pass type I membrane protein