제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD200/OX2 mAb (A26860)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Mouse CD200 mAb (A26860, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 RAW 264.7 cells (negative control, left) and BALB/c splenocytes (right) were surface-stained with ABflo® 647 Rabbit anti-Mouse CD200 mAb (A26860, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD200 mAb (A26860, 5 μl/Test, right).

Flow cytometry: 1X10^6 BALB/c splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD200 mAb (A26860, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD200/OX2 mAb
Catalog No.	A26860
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC70039-ABflo647

Background

Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion. Involved in negative regulation of cell population proliferation; negative regulation of macrophage activation; and negative regulation of neuroinflammatory response. Located in cell surface. Is expressed in several structures, including anterior naris; aorta; bone; nervous system; and retina. Used to study autoimmune disease. Orthologous to human CD200 (CD200 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 31-232 of mouse CD200/OX2 (NP_034948.3).
Sequence	QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
Gene ID
Swiss Prot
Synonyms	OX2; Mox2
Calculated MW	31kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.