제품 > 항체 > 다중클론항체(pAb)

CD200 Rabbit pAb (A23050)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates, using CD200 Rabbit pAb (A23050) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	CD200 Rabbit pAb
Catalog No.	A23050
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion. Involved in negative regulation of cell population proliferation; negative regulation of macrophage activation; and negative regulation of neuroinflammatory response. Located in cell surface. Is expressed in several structures, including anterior naris; aorta; bone; nervous system; and retina. Used to study autoimmune disease. Orthologous to human CD200 (CD200 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 31-232 of mouse CD200. (NP_034948.3).
Sequence	QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
Gene ID
Swiss Prot
Synonyms	OX2; Mox2; CD200
Calculated MW	31kDa
Observed MW	45-50kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse heart, Mouse brain, Mouse lung, Rat thymus, Rat brain
Cellular location