제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD201/EPCR mAb (A23969)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 bEnd.3 cells were surface-stained with ABflo® 647 Rabbit anti-Mouse CD201/EPCR mAb(A23969, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained bEnd.3 cells were used as blank control (red line).

Flow cytometry: 1X10^6 U266 cells(negative control) cells were surface-stained with ABflo® 647 Rabbit anti-Mouse CD201/EPCR mAb(A23969, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained U266 cells were used as blank control (red line).

Flow cytometry:1X10^6 bEnd.3 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD201/EPCR mAb(A23969, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD201/EPCR mAb
Catalog No.	A23969
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62043-ABflo647

Background

Predicted to enable protein C-terminus binding activity. Predicted to be involved in negative regulation of coagulation. Predicted to act upstream of or within blood coagulation. Located in centrosome. Is expressed in several structures, including blastocyst; endocardial tissue; female reproductive system; liver; and vascular element. Orthologous to human PROCR (protein C receptor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-210 of mouse CD201/EPCR(NP_035301.2).
Sequence	LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGR
Gene ID
Swiss Prot
Synonyms	Ccca; Epcr; Ccd41
Calculated MW	27kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane