제품 > 항체 > 단일클론항체(mAb)

EPCR/CD201 Rabbit mAb (A23838)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse spleen using EPCR/CD201 Rabbit mAb (A23838) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	EPCR/CD201 Rabbit mAb
Catalog No.	A23838
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61930

Background

Predicted to enable protein C-terminus binding activity. Predicted to be involved in negative regulation of coagulation. Predicted to act upstream of or within blood coagulation. Located in centrosome. Is expressed in several structures, including blastocyst; endocardial tissue; female reproductive system; liver; and vascular element. Orthologous to human PROCR (protein C receptor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-210 of mouse EPCR/CD201(NP_035301.2).
Sequence	LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGR
Gene ID
Swiss Prot
Synonyms	Ccca; Epcr; Ccd41; EPCR/CD201
Calculated MW	27kDa
Observed MW	45kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse spleen
Cellular location	Membrane.