제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD209b/DC-SIGNR1 mAb (A26548)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD209b/DC-SIGNR1 mAb (A26548, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD209b/DC-SIGNR1 mAb
Catalog No.	A26548
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69315-ABflo647

Background

CD209B, also known as SIGN-R1, is a mouse C-type lectin receptor predominantly expressed on macrophages in the spleen marginal zone and lymph nodes medulla. CD209B is a mouse homolog of human CD209/DC-SIGN and is involved in innate immune response. CD209B mediates the recognition and uptake of pathogen products, such as lipopolysaccharides (LPS), pneumococcal polysaccharides, and dextrans. CD209B has been demonstrated to facilitate the clearance of encapsulated pneumococcus by directly binding to C1q and activating complement through an immunoglobulin independent pathway.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 76-325 of mouse CD209b/DC-SIGNR1 (NP_081248.4).
Sequence	SKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG
Gene ID
Swiss Prot
Synonyms	OtB7; SIGNR1; mSIGNR1; DC-SIGNR1; 1810030I22Rik
Calculated MW	16kDa/33kDa/36kDa/37kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type II membrane protein.