Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | PerCP Rabbit anti-Mouse CD209b/DC-SIGNR1 mAb |
---|---|
Catalog No. | A26547 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC69315-PerCP |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 76-325 of mouse CD209b/DC-SIGNR1 (NP_081248.4). |
---|---|
Sequence | SKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG |
Gene ID | |
Swiss Prot | |
Synonyms | OtB7; SIGNR1; mSIGNR1; DC-SIGNR1; 1810030I22Rik |
Calculated MW | 16kDa/33kDa/36kDa/37kDa |
Observed MW | Refer to figures |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Membrane, Single-pass type II membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.