제품 > 항체 > 단일클론항체(mAb)

ABflo® 700 Rabbit anti-Human CD152/CTLA-4 mAb (A26551)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 700 Rabbit anti-Human CD152/CTLA-4 mAb (A26551, 5 μl/Test, orange line) or ABflo® 700 Rabbit IgG isotype control (A25976, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 700 Rabbit IgG isotype control (A25976, 5 μl/Test, left) or ABflo® 700 Rabbit anti-Human CD152/CTLA-4 mAb (A26551, 5 μl/Test, right).

Overview

Product name	ABflo® 700 Rabbit anti-Human CD152/CTLA-4 mAb
Catalog No.	A26551
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57384-ABflo700

Background

This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 37-162 of human CD152/CTLA-4 (NP_005205.2).
Sequence	AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Gene ID
Swiss Prot
Synonyms	CD; GSE; GRD4; ALPS5; CD152; CTLA-4; IDDM12; CELIAC3
Calculated MW	25kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	clathrin-coated endocytic vesicle, external side of plasma membrane, Golgi apparatus, perinuclear region of cytoplasm, plasma membrane, Cell membrane, Single-pass type I membrane protein.