제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD152/CTLA-4 mAb (A23713)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells(negative control, left) and 293F(Transfection, right) cells were surface-stained with PE Rabbit anti-Human CD152/CTLA-4 mAb(A23713, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Human CD152/CTLA-4 mAb(A23713, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human CD152/CTLA-4 mAb
Catalog No.	A23713
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57384-PE

Background

This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 37-162 of human CD152/CTLA-4 (NP_005205.2)
Sequence	AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Gene ID
Swiss Prot
Synonyms	CD; GSE; GRD4; ALPS5; CD152; CTLA-4; IDDM12; CELIAC3
Calculated MW	6kDa/8kDa/19kDa/24kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Clathrin-coated endocytic vesicle, external side of plasma membrane, golgi apparatus, perinuclear region of cytoplasm, plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human CD152/CTLA-4 mAb images

Flow CytoMetry - PE Rabbit anti-Human CD152/CTLA-4 mAb (A23713)

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Human CD152/CTLA-4 mAb(A23713, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.