제품 > 항체 > 단일클론항체(mAb)

ABflo® 700 Rabbit anti-Human CD89 mAb (A26637)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 700 Rabbit anti-Human CD89 mAb (A26637, 5 μl/Test, orange line) or ABflo® 700 Rabbit IgG isotype control (A25976, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 700 Rabbit IgG isotype control (A25976, 5 μl/Test, left) or ABflo® 700 Rabbit anti-Human CD89 mAb (A26637, 5 μl/Test, right).

Overview

Product name	ABflo® 700 Rabbit anti-Human CD89 mAb
Catalog No.	A26637
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59839-ABflo700

Background

This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-227 of human CD89 (NP_001991.1).
Sequence	QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
Gene ID
Swiss Prot
Synonyms	CD89; FcalphaR; FcalphaRI; CTB-61M7.2
Calculated MW	32kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	extracellular region, plasma membrane, Plasma membrane, Secreted, Cell membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 700 Rabbit anti-Human CD89 mAb images

Flow CytoMetry - ABflo® 700 Rabbit anti-Human CD89 mAb (A26637)

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 700 Rabbit IgG isotype control (A25976, 5 μl/Test, left) or ABflo® 700 Rabbit anti-Human CD89 mAb (A26637, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.