Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ACSL3 Rabbit mAb |
---|---|
Catalog No. | A22085 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55219 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2). |
---|---|
Sequence | ALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL |
Gene ID | |
Swiss Prot | |
Synonyms | ACS3; FACL3; LACS3; LACS 3; PRO2194; ACSL3 |
Calculated MW | 80kDa |
Observed MW | 75kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | K-562, HeLa, Mouse spinal cord, Rat brain |
Cellular location | Endoplasmic reticulum membrane, Microsome membrane, Mitochondrion outer membrane, Peroxisome membrane, Single-pass type III membrane protein. |
Customer validation | IF(Mus musculus) WB(Mus musculus) WB(Homo sapiens, Mus musculus) FC(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22085? Please let us know so that we can cite the reference in this datasheet.