제품 > 항체 > 단일클론항체(mAb)

ACSL3 Rabbit mAb (A22085)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ACSL3 Rabbit mAb (A22085) at1:30000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - ACSL3 Rabbit mAb (A22085)

Confocal imaging of K-562 cells using ACSL3 Rabbit mAb (A22085, dilution 1:200)(Red).DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	ACSL3 Rabbit mAb
Catalog No.	A22085
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55219

Background

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2).
Sequence	ALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL
Gene ID
Swiss Prot
Synonyms	ACS3; FACL3; LACS3; LACS 3; PRO2194; ACSL3
Calculated MW	80kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:10000 - 1:30000 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	K-562, HeLa, Mouse spinal cord, Rat brain
Cellular location	Endoplasmic reticulum membrane, Microsome membrane, Mitochondrion outer membrane, Peroxisome membrane, Single-pass type III membrane protein.
Customer validation	IF(Mus musculus) WB(Mus musculus) WB(Homo sapiens)