Review (1)Publications (38) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using AIF1/IBA1 Rabbit mAb (A19776) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of lysates from Mouse brain using AIF1/IBA1 Rabbit mAb (A19776) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunohistochemistry analysis of paraffin-embedded Rat brain using AIF1/IBA1 Rabbit mAb (A19776) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human brain using AIF1/IBA1 Rabbit mAb (A19776) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain using AIF1/IBA1 Rabbit mAb (A19776) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver using AIF1/IBA1 Rabbit mAb (A19776) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Mouse brain using AIF1/IBA1 Rabbit mAb (A19776, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Rat brain using AIF1/IBA1 Rabbit mAb (A19776, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
| Product name | AIF1/IBA1 Rabbit mAb |
|---|---|
| Catalog No. | A19776 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2301 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse AIF1/IBA1 (O70200). |
|---|---|
| Sequence | MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEET |
| Gene ID | |
| Swiss Prot | |
| Synonyms | G1; Iba1; AIF-1; D17H6S50E; AIF1/IBA1 |
| Calculated MW | 17kDa |
| Observed MW | 17kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | THP-1, RAW 264.7, Mouse testis, Mouse spleen, Mouse brain, Rat lung, Rat testis, Rat spleen, Mouse brain |
| Cellular location | |
| Customer validation | (Mouse brain tissue) IHC(Rattus norvegicus, Mus musculus) IF(Mus musculus, Rattus norvegicus, Homo sapiens) WB(Mus musculus, Rattus norvegicus, Sus domesticus) IF(Rattus norvegicus, Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19776? Please let us know so that we can cite the reference in this datasheet.
