Review (1)Publications (39) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | AIF1/IBA1 Rabbit mAb |
---|---|
Catalog No. | A19776 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2301 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse AIF1/IBA1 (O70200). |
---|---|
Sequence | MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEET |
Gene ID | |
Swiss Prot | |
Synonyms | G1; Iba1; AIF-1; D17H6S50E; AIF1/IBA1 |
Calculated MW | 17kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | THP-1, RAW 264.7, Mouse testis, Mouse spleen, Mouse brain, Rat lung, Rat testis, Rat spleen, Mouse brain |
Cellular location | |
Customer validation | (Mouse brain tissue) IHC(Rattus norvegicus, Mus musculus) IF(Mus musculus, Rattus norvegicus, Homo sapiens) WB(Mus musculus, Rattus norvegicus, Sus domesticus) IF(Rattus norvegicus, Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19776? Please let us know so that we can cite the reference in this datasheet.