제품 > 항체 > 다중클론항체(pAb)

AKT1S1/PRAS40 Rabbit pAb (A6238)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using AKT1S1/PRAS40 Rabbit pAb (A6238) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - AKT1S1/PRAS40 Rabbit pAb (A6238)

Immunohistochemistry analysis of paraffin-embedded Human mammary cancer using AKT1S1/PRAS40 Rabbit pAb (A6238) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human stomach using AKT1S1/PRAS40 Rabbit pAb (A6238) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - AKT1S1/PRAS40 Rabbit pAb (A6238)

Immunofluorescence analysis of NIH-3T3 cells using AKT1S1/PRAS40 Rabbit pAb (A6238) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	AKT1S1/PRAS40 Rabbit pAb
Catalog No.	A6238
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-256 of human AKT1S1/PRAS40 (NP_001092103.1).
Sequence	STDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY
Gene ID
Swiss Prot
Synonyms	Lobe; PRAS40; AKT1S1/PRAS40
Calculated MW	27kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse heart, Rat heart
Cellular location	Cytoplasm, cytosol.
Customer validation	IF(Rattus norvegicus) WB(Rattus norvegicus)