제품 > 항체 > 단일클론항체(mAb)

ALDH1A1 Rabbit PolymAb® (A22531PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using ALDH1A1 Rabbit PolymAb® (A22531PM) at 1:50000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): THP-1
Exposure time: 20s.

Western blot analysis of lysates from rat lung, using ALDH1A1 Rabbit PolymAb® (A22531PM) at 1:50000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.

ABclonal:Immunohistochemistry - ALDH1A1 Rabbit PolymAb® (A22531PM)

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using ALDH1A1 Rabbit PolymAb® (A22531PM) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using ALDH1A1 Rabbit PolymAb® (A22531PM) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using ALDH1A1 Rabbit PolymAb® (A22531PM) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using ALDH1A1 Rabbit PolymAb® (A22531PM) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - ALDH1A1 Rabbit PolymAb® (A22531PM)

Immunofluorescence analysis of A-549 cells using ALDH1A1 Rabbit PolymAb® (A22531PM) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 cells using ALDH1A1 Rabbit PolymAb® (A22531PM) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	ALDH1A1 Rabbit PolymAb®
Catalog No.	A22531PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 Rabbit PolymAb® (NP_000680.2).
Sequence	VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
Gene ID
Swiss Prot
Synonyms	ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e
Calculated MW	55kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:10000 - 1:60000 IHC-P 1:100 - 1:500 IF/ICC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A549, Hep G2, Mouse liver, Mouse testis, Rat lung
Cellular location	Cytoplasm.