제품 > 항체 > 다중클론항체(pAb)

AMPD1 Rabbit pAb (A3584)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using AMPD1 antibody (A3584) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - AMPD1 Rabbit pAb (A3584)

Immunofluorescence analysis of NIH/3T3 cells using AMPD1 Rabbit pAb (A3584) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using AMPD1 Rabbit pAb (A3584) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using AMPD1 Rabbit pAb (A3584) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	AMPD1 Rabbit pAb
Catalog No.	A3584
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Adenosine monophosphate deaminase 1 catalyzes the deamination of AMP to IMP in skeletal muscle and plays an important role in the purine nucleotide cycle. Two other genes have been identified, AMPD2 and AMPD3, for the liver- and erythocyte-specific isoforms, respectively. Deficiency of the muscle-specific enzyme is apparently a common cause of exercise-induced myopathy and probably the most common cause of metabolic myopathy in the human. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-260 of human AMPD1 (NP_001166097.1).
Sequence	AEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIPLSETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANESFYPVFTPPVKKGEDPFRTDNLPENLGYHLKMKDGVVYVYPNEAAVSKDEPKP
Gene ID
Swiss Prot
Synonyms	MAD; MADA; MMDD
Calculated MW	86kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A375, SKOV3, A-549, Mouse heart, Mouse lung, Rat skeletal muscle, Rat heart
Cellular location	cytosol
Customer validation	WB(Rattus norvegicus) IHC(Rattus norvegicus)