Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | APC Rabbit anti-Human CD24 mAb |
---|---|
Catalog No. | A25888 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC66763-APC |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-80 of human CD24 (NP_037362.1). |
---|---|
Sequence | MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS |
Gene ID | |
Swiss Prot | |
Synonyms | CD24A; CD24 |
Calculated MW | 8kDa; 13kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Cell membrane, GPI-anchor, Lipid-anchor. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.