Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with APC Rabbit anti-Human Siglec-7/CD328 mAb (A27282, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human Siglec-7/CD328 mAb (A27282, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 610 Rabbit anti-Human CD56/NCAM1 mAb (A26934, 5 μl/Test) and APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human Siglec-7/CD328 mAb (A27282, 5 μl/Test, right). Cells in the lymphocyte and monocytes gates were used for analysis.
| Product name | APC Rabbit anti-Human Siglec-7/CD328 mAb |
|---|---|
| Catalog No. | A27282 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC71713-APC |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-144 of human Siglec-7/CD328 (NP_055200.1). |
|---|---|
| Sequence | GQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT |
| Gene ID | |
| Swiss Prot | |
| Synonyms | p75; QA79; AIRM1; CD328; AIRM-1; CDw328; D-siglec; SIGLEC-7; SIGLECP2; SIGLEC19P; p75/AIRM1 |
| Calculated MW | 51kDa |
| Observed MW |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
| Key application | Flow Cytometry |
| Positive samples | |
| Cellular location | Membrane, Single-pass type I membrane protein, plasma membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
