제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Mouse CD272/BTLA mAb (A26261)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C2C12 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with APC Rabbit anti-Mouse CD272/BTLA mAb (A26261, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Mouse CD272/BTLA mAb (A26261, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Mouse CD272/BTLA mAb
Catalog No.	A26261
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63351-APC

Background

Enables signaling receptor activity. Acts upstream of or within immune response-regulating cell surface receptor signaling pathway; negative regulation of B cell proliferation; and negative regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Orthologous to human BTLA (B and T lymphocyte associated).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-176 of mouse CD272/BTLA (NP_001032808.2).
Sequence	EKATKRNDEECPVQLTITRNSKQSARTGELFKIQCPVKYCVHRPNVTWCKHNGTICVPLEVSPQLYTSWEENQSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLITVSDIPDATNASGPSTMEERP
Gene ID
Swiss Prot
Synonyms	A630002H24
Calculated MW	22kDa/34kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein.