제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Mouse CD34 mAb (A26123)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 Neuro-2a cells (negative control, left) and NIH/3T3 cells (right) were surface-stained with APC Rabbit anti-Mouse CD34 mAb (A26123, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	APC Rabbit anti-Mouse CD34 mAb
Catalog No.	A26123
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58336-APC

Background

Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region. Is expressed in several structures, including alimentary system; cardiovascular system; extraembryonic component; genitourinary system; and skin. Orthologous to human CD34 (CD34 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 35-287 of mouse CD34 (NP_598415.1).
Sequence	TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKT
Gene ID
Swiss Prot
Synonyms	CD34; CD34 molecule; GIG3; MORT1
Calculated MW	41kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein.