제품 > 항체 > 단일클론항체(mAb)

CD34 Rabbit mAb (A25367)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Confocal imaging of NIH/3T3 cells using CD34 Rabbit mAb (A25367, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - CD34 Rabbit mAb (A25367)

Flow cytometry: 1X10^6 Neuro-2a cells (negative control, left) and NIH/3T3 cells (right) were surface-stained with CD34 Rabbit mAb (A25367, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 NIH/3T3 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD34 Rabbit mAb (A25367, 2 μg/mL, right).

Overview

Product name	CD34 Rabbit mAb
Catalog No.	A25367
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58336

Background

Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region. Is expressed in several structures, including alimentary system; cardiovascular system; extraembryonic component; genitourinary system; and skin. Orthologous to human CD34 (CD34 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 35-287 of mouse CD34 (NP_598415.1).
Sequence	TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKT
Gene ID
Swiss Prot
Synonyms	CD34; CD34 molecule; GIG3; MORT1
Calculated MW	35kDa/41kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF 1:200 - 1:800 FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD34 Rabbit mAb images

Immunofluorescence - CD34 Rabbit mAb (A25367)

Flow CytoMetry - CD34 Rabbit mAb (A25367)

Flow cytometry: 1X10^6 NIH/3T3 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD34 Rabbit mAb (A25367, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.