제품 > 항체 > 단일클론항체(mAb)

APEX1/APE1 Rabbit mAb (A11238)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using APEX1/APE1 Rabbit mAb (A11238) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - APEX1/APE1 Rabbit mAb (A11238)

Immunohistochemistry analysis of paraffin-embedded human colon using APEX1/APE1 Rabbit mAb (A11238) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Review

Overview

Product name	APEX1/APE1 Rabbit mAb
Catalog No.	A11238
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0556

Background

The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APEX1/APE1 (P27695).
Sequence	MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCS
Gene ID
Swiss Prot
Synonyms	APE; APX; APE1; APEN; APEX; HAP1; REF1; APEX1/APE1
Calculated MW	36kDa
Observed MW	36kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, A-431, NIH/3T3, Rat testis
Cellular location	Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus, Nucleus speckle, nucleolus
Customer validation	(HepG2 、SHP-77)