제품 > 항체 > 다중클론항체(pAb)

[KO Validated] APEX1/APE1 Rabbit pAb (A2587)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using [KO Validated] APEX1/APE1 Rabbit pAb (A2587).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Western blot analysis of lysates from wild type (WT) and APEX1/APE1 knockout (KO) 293T cells, using [KO Validated] APEX1/APE1 Rabbit pAb (A2587) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] APEX1/APE1 Rabbit pAb (A2587)

Immunofluorescence analysis of HeLa cells using [KO Validated] APEX1/APE1 Rabbit pAb (A2587). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of A549 cells using [KO Validated] APEX1/APE1 Rabbit pAb (A2587).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

ABclonal:Immunoprecipitation - [KO Validated] APEX1/APE1 Rabbit pAb (A2587)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 1 μg APEX1/APE1 antibody (A2587). Western blot was performed from the immunoprecipitate using APEX1/APE1 antibody (A2587) at a dilution of 1:1000.

Overview

Product name	[KO Validated] APEX1/APE1 Rabbit pAb
Catalog No.	A2587
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human APEX1/APE1 (NP_542380.1).
Sequence	MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Gene ID
Swiss Prot
Synonyms	APE; APX; APE1; APEN; APEX; HAP1; REF1; E1
Calculated MW	36kDa
Observed MW	39kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, HepG2
Cellular location	Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus, Nucleus speckle, nucleolus
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] APEX1/APE1 Rabbit pAb images

Western blot - [KO Validated] APEX1/APE1 Rabbit pAb (A2587)

Immunofluorescence - [KO Validated] APEX1/APE1 Rabbit pAb (A2587)

Immunofluorescence analysis of A549 cells using [KO Validated] APEX1/APE1 Rabbit pAb (A2587).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Immunoprecipitation - [KO Validated] APEX1/APE1 Rabbit pAb (A2587)

* For research use only. Not for therapeutic or diagnostic purposes.