제품 > 항체 > 다중클론항체(pAb)

AQP2 Rabbit pAb (A12998)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Immunohistochemistry analysis of paraffin-embedded mouse kidney using AQP2 Rabbit pAb (A12998) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	AQP2 Rabbit pAb
Catalog No.	A12998
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a water channel protein located in the kidney collecting tubule. It belongs to the MIP/aquaporin family, some members of which are clustered together on chromosome 12q13. Mutations in this gene have been linked to autosomal dominant and recessive forms of nephrogenic diabetes insipidus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 147-271 of human AQP2 (NP_000477.1).
Sequence	ASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA
Gene ID
Swiss Prot
Synonyms	NDI2; AQP-CD; WCH-CD; AQP2
Calculated MW	29kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	Apical cell membrane, Basolateral cell membrane, Cytoplasmic vesicle membrane, Golgi apparatus, Multi-pass membrane protein, trans-Golgi network membrane