제품 > 항체 > 다중클론항체(pAb)

AQP2 Rabbit pAb (A16209)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from 293T cells, using AQP2 Rabbit pAb (A16209) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - AQP2 Rabbit pAb (A16209)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using AQP2 Rabbit pAb (A16209) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - AQP2 Rabbit pAb (A16209)

Immunofluorescence analysis of paraffin-embedded rat kidney using AQP2 Rabbit pAb (A16209) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded mouse kidney using AQP2 Rabbit pAb (A16209) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	AQP2 Rabbit pAb
Catalog No.	A16209
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a water channel protein located in the kidney collecting tubule. It belongs to the MIP/aquaporin family, some members of which are clustered together on chromosome 12q13. Mutations in this gene have been linked to autosomal dominant and recessive forms of nephrogenic diabetes insipidus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 147-271 of human AQP2 (NP_000477.1).
Sequence	ASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA
Gene ID
Swiss Prot
Synonyms	NDI2; AQP-CD; WCH-CD; AQP2
Calculated MW	29kDa
Observed MW	26kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T
Cellular location	Apical cell membrane, Basolateral cell membrane, Cytoplasmic vesicle membrane, Golgi apparatus, Multi-pass membrane protein, trans-Golgi network membrane
Customer validation	IHC(Mus musculus) WB(Mus musculus, Homo sapiens) IF(Homo sapiens)