Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ARRDC4 Rabbit pAb |
---|---|
Catalog No. | A18522 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ARRDC4 (NP_899232.2). |
---|---|
Sequence | PGAKKLMLELPLVIGTIPYNGFGSRNSSIASQFSMDMSWLTLTLPEQPEAPPNYADVVSEEEFSRHIPPYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSE |
Gene ID | |
Swiss Prot | |
Synonyms | ARRDC4 |
Calculated MW | 45kDa |
Observed MW | 45kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | PC-3 |
Cellular location | cytoplasm, early endosome, endosome, extracellular vesicle, plasma membrane |
Customer validation | IHC(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18522? Please let us know so that we can cite the reference in this datasheet.