제품 > 항체 > 단일클론항체(mAb)

ATG7 Rabbit mAb (A21895)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HepG2 cells, using ATG7 Rabbit mAb (A21895) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - ATG7 Rabbit mAb (A21895)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ATG7 Rabbit mAb (A21895) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - ATG7 Rabbit mAb (A21895)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg ATG7 antibody (A21895). Western blot was performed from the immunoprecipitate using ATG7 antibody (A21895) at a dilution of 1:500.

Overview

Product name	ATG7 Rabbit mAb
Catalog No.	A21895
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2631

Background

This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-703 of human ATG7 (O95352).
Sequence	GGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI
Gene ID
Swiss Prot
Synonyms	GSA7; APG7L; SCAR31; APG7-LIKE; ATG7
Calculated MW	78kDa
Observed MW	75kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HepG2
Cellular location	Cytoplasm, Preautophagosomal structure
Customer validation	WB(Actinopterygii)