Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ATP2B1 Rabbit pAb |
---|---|
Catalog No. | A18688 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ATP2B1 (NP_001673.2). |
---|---|
Sequence | QESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGE |
Gene ID | |
Swiss Prot | |
Synonyms | MRD66; PMCA1; PMCA1kb |
Calculated MW | 135kDa |
Observed MW | 140kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse brain |
Cellular location | apical plasma membrane, basolateral plasma membrane, cytoplasmic side of plasma membrane, extracellular exosome, GABA-ergic synapse, glutamatergic synapse, immunological synapse, nucleoplasm, photoreceptor ribbon synapse, plasma membrane, presynaptic active zone membrane, presynaptic membrane, synaptic vesicle membrane |
Customer validation | WB(Mus musculus, Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18688? Please let us know so that we can cite the reference in this datasheet.