제품 > 항체 > 다중클론항체(pAb)

Aggrecan Rabbit pAb (A12045)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of mouse brain, using Aggrecan antibody (A12045) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - Aggrecan Rabbit pAb (A12045)

Immunofluorescence analysis of Mouse cartilage cells using Aggrecan Rabbit pAb (A12045) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Rat cartilage cells using Aggrecan antibody (A12045) at dilution of 1:100 (40x lens).Blue: DAPI for nuclear staining.

Overview

Product name	Aggrecan Rabbit pAb
Catalog No.	A12045
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human Aggrecan (NP_037359.3).
Sequence	ATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVFHYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVSPRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEA
Gene ID
Swiss Prot
Synonyms	AGC1; SEDK; AGCAN; CSPG1; MSK16; CSPGCP; SSOAOD
Calculated MW	261kDa
Observed MW	230kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain
Cellular location	Secreted, extracellular matrix, extracellular space
Customer validation	WB(Mus musculus, Rattus norvegicus, Other) IF(Homo sapiens) IHC(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구줄기세포간엽줄기세포

Aggrecan Rabbit pAb images

Western blot - Aggrecan Rabbit pAb (A12045)

Immunofluorescence - Aggrecan Rabbit pAb (A12045)

Immunofluorescence analysis of Mouse cartilage cells using Aggrecan Rabbit pAb (A12045) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - Aggrecan Rabbit pAb (A12045)

Immunofluorescence analysis of Rat cartilage cells using Aggrecan antibody (A12045) at dilution of 1:100 (40x lens).Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.