Reviews (3)Publications (9) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Alkaline Phosphatase (ALPL) Rabbit mAb (A0514) at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Alkaline Phosphatase (ALPL) Rabbit mAb (A0514) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Alkaline Phosphatase (ALPL) Rabbit mAb (A0514) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Alkaline Phosphatase (ALPL) Rabbit mAb (A0514) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Alkaline Phosphatase (ALPL) Rabbit mAb (A0514) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
| Product name | Alkaline Phosphatase (ALPL) Rabbit mAb |
|---|---|
| Catalog No. | A0514 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0245 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alkaline Phosphatase (ALPL) (P05186). |
|---|---|
| Sequence | MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKT |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HOPS; HPPA; HPPC; HPPI; HPPO; TNAP; TNALP; APTNAP; TNSALP; AP-TNAP; TNS-ALP; Alkaline Phosphatase (ALPL) |
| Calculated MW | 57kDa |
| Observed MW | 80kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HeLa, U-87 MG, Mouse liver, Rat liver |
| Cellular location | Cell membrane, GPI-anchor, Lipid-anchor. |
| Customer validation | (MC3T3-E1, MOLT-4,U-2-OS,HL-60,PC-3,Hela,HEPG2,A549, PC-3 HL-60 HEPG2 HELA MOLT4 A549 JURKAT U2-0S 293T) WB(Mus musculus, Homo sapiens) IF(Homo sapiens) RT-PCR(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0514? Please let us know so that we can cite the reference in this datasheet.
