Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Alpha-tubulin (ubiquitous) chain Rabbit pAb |
---|---|
Catalog No. | AC024 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence within amino acids 1-80 of human Alpha-tubulin (ubiquitous) chain (NP_006073.2). |
---|---|
Sequence | MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRT |
Gene ID | |
Swiss Prot | |
Synonyms | K-ALPHA-1; Alpha-tubulin (ubiquitous) chain |
Calculated MW | 50kDa |
Observed MW | 52kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, PC-12, A-549, U-251MG, Mouse brain |
Cellular location | Cytoplasm, cytoskeleton. |
Customer validation | WB(Homo sapiens,Rattus norvegicus, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using AC024? Please let us know so that we can cite the reference in this datasheet.