제품 > 항체 > Tag & 로딩 컨트롤 항체

α-Tubulin Rabbit mAb (AC049)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells, using α-Tubulin Rabbit mAb (AC049) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Immunohistochemistry - α-Tubulin Rabbit mAb (AC049)

Immunohistochemistry analysis of α-Tubulin in paraffin-embedded human cervix cancer tissue using α-Tubulin Rabbit mAb (AC049) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of α-Tubulin in paraffin-embedded human colon carcinoma tissue using α-Tubulin Rabbit mAb (AC049) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of α-Tubulin in paraffin-embedded human tonsil tissue using α-Tubulin Rabbit mAb (AC049) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of α-Tubulin in paraffin-embedded mouse kidney tissue using α-Tubulin Rabbit mAb (AC049) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of α-Tubulin in paraffin-embedded mouse testis tissue using α-Tubulin Rabbit mAb (AC049) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of α-Tubulin in paraffin-embedded rat colon tissue using α-Tubulin Rabbit mAb (AC049) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - α-Tubulin Rabbit mAb (AC049)

Confocal imaging of HeLa cells using α-Tubulin Rabbit mAb (AC049, dilution 1:100)(Green). The cells were counterstained with RAB11A Rabbit mAb (A3251, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	α-Tubulin Rabbit mAb
Catalog No.	AC049
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51243

Background

Enables double-stranded RNA binding activity and ubiquitin protein ligase binding activity. Predicted to be involved in microtubule cytoskeleton organization and mitotic cell cycle. Predicted to act upstream of or within cellular response to interleukin-4. Located in microtubule.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-42 of human α-Tubulin(NP_006073.2).
Sequence	MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI
Gene ID
Swiss Prot
Synonyms	K-ALPHA-1; α-Tubulin
Calculated MW	50kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa
Cellular location	cytoplasm, cytoplasmic microtubule, microtubule cytoskeleton
Customer validation	WB(Homo sapiens)