Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Apolipoprotein A1/APOA1 Rabbit mAb |
---|---|
Catalog No. | A24290 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC63059 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human Apolipoprotein A1/APOA1 (NP_000030.1). |
---|---|
Sequence | DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
Gene ID | |
Swiss Prot | |
Synonyms | HPALP2; apo(a); Apolipoprotein A1/APOA1 |
Calculated MW | 28kDa |
Observed MW | 28kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Hep G2, Mouse plasma, Rat plasma |
Cellular location | Blood microparticle, cytoplasmic vesicle, cytosol, early endosome, endoplasmic reticulum lumen, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, plasma membrane. |
Customer validation | WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24290? Please let us know so that we can cite the reference in this datasheet.