제품 > 항체 > 단일클론항체(mAb)

Apolipoprotein A1/APOA1 Rabbit mAb (A24291)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using Apolipoprotein A1/APOA1 Rabbit mAb (A24291) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Mouse plasma, using Apolipoprotein A1/APOA1 Rabbit mAb (A24291) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - Apolipoprotein A1/APOA1 Rabbit mAb (A24291)

Immunofluorescence analysis of HepG2 cells using Apolipoprotein A1/APOA1Rabbit mAb (A24291) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Apolipoprotein A1/APOA1 Rabbit mAb (A24291)

Immunoprecipitation analysis of 300ug extracts of Hep G2 cells using 3ug Apolipoprotein A1/APOA1Rabbit mAb (A24291). Western blot was performed from the immunoprecipitate using Apolipoprotein A1/APOA1Rabbit mAb (A24290) at a dilition of 1:2000.

Overview

Product name	Apolipoprotein A1/APOA1 Rabbit mAb
Catalog No.	A24291
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63063

Background

This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human Apolipoprotein A1/APOA1 (NP_000030.1).
Sequence	DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Gene ID
Swiss Prot
Synonyms	HPALP2; apo(a); Apolipoprotein A1/APOA1
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:4000 IF/ICC 1:200 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	Hep G2, Mouse plasma
Cellular location	Blood microparticle, cytoplasmic vesicle, cytosol, early endosome, endoplasmic reticulum lumen, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, plasma membrane.