Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Apolipoprotein A1 Rabbit mAb |
---|---|
Catalog No. | A4163 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0911 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A1 (P02647). |
---|---|
Sequence | MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLE |
Gene ID | |
Swiss Prot | |
Synonyms | HPALP2; apo(a); Apolipoprotein A1 |
Calculated MW | 28kDa |
Observed MW | 25kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Human plasma |
Cellular location | Blood microparticle, cytoplasmic vesicle, cytosol, early endosome, endoplasmic reticulum lumen, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, plasma membrane. |
Customer validation | WB(Homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4163? Please let us know so that we can cite the reference in this datasheet.