제품 > 항체 > 단일클론항체(mAb)

[KO Validated] LKB1 Rabbit mAb (A22636)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type(WT) and LKB1 knockout (KO) 293T cells, using [KO Validated] LKB1 Rabbit mAb (A22636) at 1:7000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - [KO Validated] LKB1 Rabbit mAb (A22636)

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KO Validated] LKB1 Rabbit mAb (A22636) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] LKB1 Rabbit mAb (A22636) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - [KO Validated] LKB1 Rabbit mAb (A22636)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg LKB1 antibody (A22636). Western blot was performed from the immunoprecipitate using LKB1 antibody (A22636) at a dilution of 1:7000.

Overview

Product name	[KO Validated] LKB1 Rabbit mAb
Catalog No.	A22636
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58343

Background

The protein encoded by this gene is a serine/threonine kinase that regulates cell polarity and energy metabolism and functions as a tumor suppressor. Mutations in this gene have been associated with the autosomal dominant Peutz-Jeghers syndrome, as well as with skin, pancreatic, and testicular cancers.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 134-433 of human LKB1. (NP_000446.1).
Sequence	CGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ
Gene ID
Swiss Prot
Synonyms	PJS; LKB1; hLKB1; B1
Calculated MW	49kDa
Observed MW	49-60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:3500 - 1:14000 IHC-P 1:200 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	293T, MCF7, L929, mouse testis, PC-12
Cellular location	Cytoplasm, Membrane, Mitochondrion, Nucleus.
Customer validation	WB(Fathead minnow, Homo sapiens)