Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Apolipoprotein A2 Rabbit mAb |
---|---|
Catalog No. | A3321 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1946 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Apolipoprotein A2 (NP_001634.1). |
---|---|
Sequence | MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ |
Gene ID | |
Swiss Prot | |
Synonyms | apoAII; Apo-AII; ApoA-II |
Calculated MW | 17kDa |
Observed MW | 10kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Human plasma |
Cellular location | Blood microparticle, Cytosol, Early endosome, Endoplasmic reticulum lumen, Extracellular exosome, Extracellular region |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.