제품 > 항체 > 단일클론항체(mAb)

Apolipoprotein A2 Rabbit mAb (A3321)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of Human plasma cells, using Apolipoprotein A2 antibody (A3321) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - Apolipoprotein A2 Rabbit mAb (A3321)

Immunofluorescence analysis of rat liver using Apolipoprotein A2 Rabbit mAb (A3321) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse liver using Apolipoprotein A2 Rabbit mAb (A3321) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Apolipoprotein A2 Rabbit mAb
Catalog No.	A3321
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1946

Background

This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Apolipoprotein A2 (NP_001634.1).
Sequence	MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Gene ID
Swiss Prot
Synonyms	apoAII; Apo-AII; ApoA-II
Calculated MW	17kDa
Observed MW	10kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Human plasma
Cellular location	Blood microparticle, Cytosol, Early endosome, Endoplasmic reticulum lumen, Extracellular exosome, Extracellular region

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Apolipoprotein A2 Rabbit mAb images

Western blot - Apolipoprotein A2 Rabbit mAb (A3321)

Immunofluorescence - Apolipoprotein A2 Rabbit mAb (A3321)

Immunofluorescence analysis of rat liver using Apolipoprotein A2 Rabbit mAb (A3321) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - Apolipoprotein A2 Rabbit mAb (A3321)

Immunofluorescence analysis of mouse liver using Apolipoprotein A2 Rabbit mAb (A3321) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.