제품 > 항체 > 단일클론항체(mAb)

Arginase-1 Rabbit mAb (A25808)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Arginase-1 Rabbit mAb (A25808)at 1:10000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Mouse small intestine
Exposure time: 20s.

ABclonal:Immunohistochemistry - Arginase-1 Rabbit mAb (A25808)

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Arginase-1 Rabbit mAb (A25808) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Arginase-1 Rabbit mAb (A25808) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Arginase-1 Rabbit mAb (A25808) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Arginase-1 Rabbit mAb (A25808)

Confocal imaging of paraffin-embedded Human liver tissue using Arginase-1 Rabbit mAb (A25808, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Mouse liver tissue using Arginase-1 Rabbit mAb (A25808, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	Arginase-1 Rabbit mAb
Catalog No.	A25808
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65709

Background

Enables arginase activity. Involved in defense response to protozoan; negative regulation of T-helper 2 cell cytokine production; and negative regulation of activated T cell proliferation. Predicted to be located in several cellular components, including extracellular space; mitochondrial outer membrane; and neuronal cell body. Predicted to be active in cytosol. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Used to study hyperargininemia. Human ortholog(s) of this gene implicated in asthma; hepatocellular carcinoma; and hyperargininemia. Orthologous to human ARG1 (arginase 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of mouse Arginase-1 (NP_031508.1).
Sequence	MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGD
Gene ID
Swiss Prot
Synonyms	AI; PGIF; Arg-1; Arginase-1
Calculated MW	35kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:10000 - 1:40000 IHC-P 1:800 - 1:8000 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse liver, Rat liver
Cellular location	cytoplasmic exosome (RNase complex), cytosol, nuclear exosome (RNase complex), nucleolar exosome (RNase complex), nucleolus, nucleoplasm, nucleus.